| Class b: All beta proteins [48724] (176 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.1: Single hybrid motif [51230] (2 families) ![]() 7 to 8 strands in 2 beta-sheets |
| Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins) |
| Protein Protein H of glycine cleavage system [51236] (4 species) |
| Species Escherichia coli K-12 [TaxId:83333] [189182] (6 PDB entries) |
| Domain d3a8ke_: 3a8k E: [171875] Other proteins in same PDB: d3a8ka1, d3a8ka2, d3a8kb1, d3a8kb2, d3a8kc1, d3a8kc2, d3a8kd1, d3a8kd2 automated match to d1onla_ |
PDB Entry: 3a8k (more details), 1.95 Å
SCOPe Domain Sequences for d3a8ke_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a8ke_ b.84.1.1 (E:) Protein H of glycine cleavage system {Escherichia coli K-12 [TaxId: 83333]}
nvpaelkyskehewlrkeadgtytvgitehaqellgdmvfvdlpevgatvsagddcavae
svkaasdiyapvsgeivavndalsdspelvnsepyaggwifkikasdeseleslldatay
ealled
Timeline for d3a8ke_: