Lineage for d3a8kc2 (3a8k C:277-362)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1544753Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544910Superfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (2 families) (S)
  5. 1544935Family b.44.2.0: automated matches [231768] (1 protein)
    not a true family
  6. 1544936Protein automated matches [231769] (1 species)
    not a true protein
  7. 1544937Species Escherichia coli K-12 [TaxId:83333] [231770] (3 PDB entries)
  8. 1544940Domain d3a8kc2: 3a8k C:277-362 [231783]
    Other proteins in same PDB: d3a8ka1, d3a8kb1, d3a8kc1, d3a8kd1, d3a8ke_, d3a8kf_
    automated match to d1vloa1

Details for d3a8kc2

PDB Entry: 3a8k (more details), 1.95 Å

PDB Description: crystal structure of etd97n-ehred complex
PDB Compounds: (C:) Aminomethyltransferase

SCOPe Domain Sequences for d3a8kc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a8kc2 b.44.2.0 (C:277-362) automated matches {Escherichia coli K-12 [TaxId: 83333]}
teklvglvmtekgvlrnelpvrftdaqgnqhegiitsgtfsptlgysialarvpegiget
aivqirnrempvkvtkpvfvrngkav

SCOPe Domain Coordinates for d3a8kc2:

Click to download the PDB-style file with coordinates for d3a8kc2.
(The format of our PDB-style files is described here.)

Timeline for d3a8kc2: