Class b: All beta proteins [48724] (176 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.1: Single hybrid motif [51230] (2 families) 7 to 8 strands in 2 beta-sheets |
Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins) |
Protein Protein H of glycine cleavage system [51236] (4 species) |
Species Thermus thermophilus [TaxId:274] [102003] (1 PDB entry) |
Domain d1onla_: 1onl A: [93362] |
PDB Entry: 1onl (more details), 2.5 Å
SCOPe Domain Sequences for d1onla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1onla_ b.84.1.1 (A:) Protein H of glycine cleavage system {Thermus thermophilus [TaxId: 274]} dipkdrfytkthewalpegdtvlvgitdyaqdalgdvvyvelpevgrvvekgeavavves vktasdiyapvageivevnlalektpelvnqdpygegwifrlkprdmgdldelldaggyq evlesea
Timeline for d1onla_: