Lineage for d3a8if_ (3a8i F:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1560127Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1560128Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 1560129Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)
  6. 1560174Protein Protein H of glycine cleavage system [51236] (4 species)
  7. 1560175Species Escherichia coli K-12 [TaxId:83333] [189182] (6 PDB entries)
  8. 1560183Domain d3a8if_: 3a8i F: [171872]
    Other proteins in same PDB: d3a8ia1, d3a8ia2, d3a8ib1, d3a8ib2, d3a8ic1, d3a8ic2, d3a8id1, d3a8id2
    automated match to d1onla_
    complexed with c2f, po4

Details for d3a8if_

PDB Entry: 3a8i (more details), 1.99 Å

PDB Description: Crystal Structure of ET-EHred-5-CH3-THF complex
PDB Compounds: (F:) glycine cleavage system H protein

SCOPe Domain Sequences for d3a8if_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a8if_ b.84.1.1 (F:) Protein H of glycine cleavage system {Escherichia coli K-12 [TaxId: 83333]}
snvpaelkyskehewlrkeadgtytvgitehaqellgdmvfvdlpevgatvsagddcava
esvkaasdiyapvsgeivavndalsdspelvnsepyaggwifkikasdeseleslldata
yeallede

SCOPe Domain Coordinates for d3a8if_:

Click to download the PDB-style file with coordinates for d3a8if_.
(The format of our PDB-style files is described here.)

Timeline for d3a8if_: