| Class b: All beta proteins [48724] (176 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.1: Single hybrid motif [51230] (2 families) ![]() 7 to 8 strands in 2 beta-sheets |
| Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins) |
| Protein Protein H of glycine cleavage system [51236] (4 species) |
| Species Escherichia coli K-12 [TaxId:83333] [189182] (6 PDB entries) |
| Domain d3a8if_: 3a8i F: [171872] Other proteins in same PDB: d3a8ia1, d3a8ia2, d3a8ib1, d3a8ib2, d3a8ic1, d3a8ic2, d3a8id1, d3a8id2 automated match to d1onla_ complexed with c2f, po4 |
PDB Entry: 3a8i (more details), 1.99 Å
SCOPe Domain Sequences for d3a8if_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a8if_ b.84.1.1 (F:) Protein H of glycine cleavage system {Escherichia coli K-12 [TaxId: 83333]}
snvpaelkyskehewlrkeadgtytvgitehaqellgdmvfvdlpevgatvsagddcava
esvkaasdiyapvsgeivavndalsdspelvnsepyaggwifkikasdeseleslldata
yeallede
Timeline for d3a8if_: