SCOPe 2.04: Domain d3a8ie_: 3a8i E:

Lineage for d3a8ie_ (3a8i E:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (2 families)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)

6. Protein Protein H of glycine cleavage system [51236] (4 species)

7. Species Escherichia coli K-12 [TaxId:83333] [189182] (6 PDB entries)

8. Domain d3a8ie_: 3a8i E: [171871]
   Other proteins in same PDB: d3a8ia1, d3a8ia2, d3a8ib1, d3a8ib2, d3a8ic1, d3a8ic2, d3a8id1, d3a8id2
   automated match to d1onla_
   complexed with c2f, po4

Details for d3a8ie_

PDB Entry: 3a8i, 1.99 Å

PDB Description: Crystal Structure of ET-EHred-5-CH3-THF complex

PDB Compounds: (E:) glycine cleavage system H protein

SCOPe Domain Sequences for d3a8ie_:

Sequence; same for both SEQRES and ATOM records:

>d3a8ie_ b.84.1.1 (E:) Protein H of glycine cleavage system {Escherichia coli K-12 [TaxId: 83333]}
snvpaelkyskehewlrkeadgtytvgitehaqellgdmvfvdlpevgatvsagddcava
esvkaasdiyapvsgeivavndalsdspelvnsepyaggwifkikasdeseleslldata
yeallede

Timeline for d3a8ie_:

• d3a8ie_ first appeared in SCOPe 2.01
  
• d3a8ie_ appears in SCOPe 2.03
  
• d3a8ie_ appears in SCOPe 2.05
  
• d3a8ie_ appears in the current release, SCOPe 2.08