SCOPe 2.01: Domain d3a6ph_: 3a6p H:

Lineage for d3a6ph_ (3a6p H:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ran [52609] (2 species)

7. Species Dog (Canis familiaris) [TaxId:9615] [52610] (7 PDB entries)
   Uniprot P62825

8. Domain d3a6ph_: 3a6p H: [171828]
   automated match to d1byub_
   protein/RNA complex; complexed with gtp, mg

Details for d3a6ph_

PDB Entry: 3a6p, 2.92 Å

PDB Description: Crystal structure of Exportin-5:RanGTP:pre-miRNA complex

PDB Compounds: (H:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d3a6ph_:

Sequence; same for both SEQRES and ATOM records:

>d3a6ph_ c.37.1.8 (H:) Ran {Dog (Canis familiaris) [TaxId: 9615]}
pqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdt
agqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdi
kdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlef

Timeline for d3a6ph_:

• d3a6ph_ is new in SCOPe 2.01-stable
  
• d3a6ph_ appears in SCOPe 2.02
  
• d3a6ph_ appears in the current release, SCOPe 2.08