Lineage for d3a5wi_ (3a5w I:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1169030Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 1169352Protein automated matches [190100] (10 species)
    not a true protein
  7. 1169353Species Aeropyrum pernix [TaxId:272557] [186846] (8 PDB entries)
  8. 1169411Domain d3a5wi_: 3a5w I: [171768]
    automated match to d1x0ra1

Details for d3a5wi_

PDB Entry: 3a5w (more details), 2.2 Å

PDB Description: Peroxiredoxin (wild type) from Aeropyrum pernix K1 (reduced form)
PDB Compounds: (I:) Probable peroxiredoxin

SCOPe Domain Sequences for d3a5wi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a5wi_ c.47.1.10 (I:) automated matches {Aeropyrum pernix [TaxId: 272557]}
pgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarry
edfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesa
thtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneii
geglivpppttedqararmesgqyrcldwwfcwdtpasrddveearrylrraaekpakll
yeea

SCOPe Domain Coordinates for d3a5wi_:

Click to download the PDB-style file with coordinates for d3a5wi_.
(The format of our PDB-style files is described here.)

Timeline for d3a5wi_: