Lineage for d2ztya_ (2zty A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1795288Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)
  6. 1795471Protein automated matches [190384] (12 species)
    not a true protein
  7. 1795487Species Human coxsackievirus B3 [TaxId:12072] [188738] (7 PDB entries)
  8. 1795494Domain d2ztya_: 2zty A: [171520]
    automated match to d1l1na_

Details for d2ztya_

PDB Entry: 2zty (more details), 1.72 Å

PDB Description: crystal structure of 3C protease from CVB3 in space group C2
PDB Compounds: (A:) 3C proteinase

SCOPe Domain Sequences for d2ztya_:

Sequence, based on SEQRES records: (download)

>d2ztya_ b.47.1.4 (A:) automated matches {Human coxsackievirus B3 [TaxId: 12072]}
gpafefavammkrnsstvkteygeftmlgiydrwavlprhakpgptilmndqevgvldak
elvdkdgtnleltllklnrnekfrdirgflakeevevneavlaintskfpnmyipvgqvt
eygflnlggtptkrmlmynfptragqcggvlmstgkvlgihvggnghqgfsaallkhyfn

Sequence, based on observed residues (ATOM records): (download)

>d2ztya_ b.47.1.4 (A:) automated matches {Human coxsackievirus B3 [TaxId: 12072]}
gpafefavammkrnsstvkteygeftmlgiydrwavlprhakpgptilmndqevgvldak
elvdkdgtnleltllklnrnekfrdirgflakeevevneavlaintskfpnmyipvgqvt
eygflnlggtptkrmlmynfptcggvlmstgkvlgihvggnghqgfsaallkhyfn

SCOPe Domain Coordinates for d2ztya_:

Click to download the PDB-style file with coordinates for d2ztya_.
(The format of our PDB-style files is described here.)

Timeline for d2ztya_: