Lineage for d1l1na_ (1l1n A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
barrel, closed; n=6, S=8; greek-key
duplication: consists of two domains of the same foldSuperfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) 
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins) Protein 3C cysteine protease (picornain 3C) [50604] (9 species) 
Species Human poliovirus 1 Mahoney [TaxId:12081] [74978] (2 PDB entries) 
Domain d1l1na_: 1l1n A: [73476]
Details for d1l1na_
PDB Entry: 1l1n (more details), 2.1 Å
PDB Description: poliovirus 3c proteinase
PDB Compounds: (A:) Genome polyprotein: Picornain 3CSCOPe Domain Sequences for d1l1na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l1na_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human poliovirus 1 Mahoney [TaxId: 12081]}
gpgfdyavamakrnivtattskgeftmlgvhdnvailpthaspgesividgkeveildak
aledqagtnleitiitlkrnekfrdirphiptqitetndgvlivntskypnmyvpvgavt
eqgylnlggrqtartlmynfptragqcggvitctgkvigmhvggngshgfaaalkrsyft
SCOPe Domain Coordinates for d1l1na_:
Click to download the PDB-style file with coordinates for d1l1na_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1l1na_:
- d1l1na_ first appeared in SCOP 1.61
- d1l1na_ appears in SCOPe 2.04
- d1l1na_ appears in SCOPe 2.06
- d1l1na_ appears in the current release, SCOPe 2.08
View in 3D
