Lineage for d2zl3d_ (2zl3 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2852295Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2852296Protein Clp protease, ClpP subunit [52098] (11 species)
  7. 2852341Species Helicobacter pylori [TaxId:210] [188429] (4 PDB entries)
  8. 2852387Domain d2zl3d_: 2zl3 D: [171343]
    automated match to d1tyfa_

Details for d2zl3d_

PDB Entry: 2zl3 (more details), 2.81 Å

PDB Description: crystal structure of h.pylori clpp s99a
PDB Compounds: (D:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d2zl3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zl3d_ c.14.1.1 (D:) Clp protease, ClpP subunit {Helicobacter pylori [TaxId: 210]}
diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
dtmnfirpdvsticigqaaamgafllscgakgkrfslphsrimihqplggaqgqasdiei
isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlq

SCOPe Domain Coordinates for d2zl3d_:

Click to download the PDB-style file with coordinates for d2zl3d_.
(The format of our PDB-style files is described here.)

Timeline for d2zl3d_: