Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
Protein Clp protease, ClpP subunit [52098] (11 species) |
Species Helicobacter pylori [TaxId:210] [188429] (4 PDB entries) |
Domain d2zl3d_: 2zl3 D: [171343] automated match to d1tyfa_ |
PDB Entry: 2zl3 (more details), 2.81 Å
SCOPe Domain Sequences for d2zl3d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zl3d_ c.14.1.1 (D:) Clp protease, ClpP subunit {Helicobacter pylori [TaxId: 210]} diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy dtmnfirpdvsticigqaaamgafllscgakgkrfslphsrimihqplggaqgqasdiei isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlq
Timeline for d2zl3d_: