| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
| Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
| Protein Clp protease, ClpP subunit [52098] (11 species) |
| Species Helicobacter pylori [TaxId:210] [188429] (4 PDB entries) |
| Domain d2zl3l_: 2zl3 L: [171351] automated match to d1tyfa_ |
PDB Entry: 2zl3 (more details), 2.81 Å
SCOPe Domain Sequences for d2zl3l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zl3l_ c.14.1.1 (L:) Clp protease, ClpP subunit {Helicobacter pylori [TaxId: 210]}
diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
dtmnfirpdvsticigqaaamgafllscgakgkrfslphsrimihqplggaqgqasdiei
isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlq
Timeline for d2zl3l_: