PDB entry 2zl3

View 2zl3 on RCSB PDB site
Description: Crystal structure of H.pylori ClpP S99A
Class: hydrolase
Keywords: S99A, Cytoplasm, Hydrolase, Protease, Serine protease
Deposited on 2008-04-02, released 2008-04-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: 0.212
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Helicobacter pylori [TaxId:210]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56156
      • engineered (98)
    Domains in SCOPe 2.06: d2zl3a_
  • Chain 'B':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Helicobacter pylori [TaxId:210]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56156
      • engineered (98)
    Domains in SCOPe 2.06: d2zl3b_
  • Chain 'C':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Helicobacter pylori [TaxId:210]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56156
      • engineered (98)
    Domains in SCOPe 2.06: d2zl3c_
  • Chain 'D':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Helicobacter pylori [TaxId:210]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56156
      • engineered (98)
    Domains in SCOPe 2.06: d2zl3d_
  • Chain 'E':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Helicobacter pylori [TaxId:210]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56156
      • engineered (98)
    Domains in SCOPe 2.06: d2zl3e_
  • Chain 'F':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Helicobacter pylori [TaxId:210]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56156
      • engineered (98)
    Domains in SCOPe 2.06: d2zl3f_
  • Chain 'G':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Helicobacter pylori [TaxId:210]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56156
      • engineered (98)
    Domains in SCOPe 2.06: d2zl3g_
  • Chain 'H':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Helicobacter pylori [TaxId:210]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56156
      • engineered (98)
    Domains in SCOPe 2.06: d2zl3h_
  • Chain 'I':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Helicobacter pylori [TaxId:210]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56156
      • engineered (98)
    Domains in SCOPe 2.06: d2zl3i_
  • Chain 'J':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Helicobacter pylori [TaxId:210]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56156
      • engineered (98)
    Domains in SCOPe 2.06: d2zl3j_
  • Chain 'K':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Helicobacter pylori [TaxId:210]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56156
      • engineered (98)
    Domains in SCOPe 2.06: d2zl3k_
  • Chain 'L':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Helicobacter pylori [TaxId:210]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56156
      • engineered (98)
    Domains in SCOPe 2.06: d2zl3l_
  • Chain 'M':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Helicobacter pylori [TaxId:210]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56156
      • engineered (98)
    Domains in SCOPe 2.06: d2zl3m_
  • Chain 'N':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Helicobacter pylori [TaxId:210]
    Gene: CLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56156
      • engineered (98)
    Domains in SCOPe 2.06: d2zl3n_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2zl3A (A:)
    mmgyipyvientdrgersydiysrllkdrivllsgeindsvassivaqllfleaedpekd
    iglyinspggvitsglsiydtmnfirpdvsticigqaaamgafllscgakgkrfslphsr
    imihqplggaqgqasdieiisneilrlkglmnsilaqnsgqsleqiakdtdrdfymsake
    akeyglidkvlqknvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zl3A (A:)
    diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
    dtmnfirpdvsticigqaaamgafllscgakgkrfslphsrimihqplggaqgqasdiei
    isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2zl3B (B:)
    mmgyipyvientdrgersydiysrllkdrivllsgeindsvassivaqllfleaedpekd
    iglyinspggvitsglsiydtmnfirpdvsticigqaaamgafllscgakgkrfslphsr
    imihqplggaqgqasdieiisneilrlkglmnsilaqnsgqsleqiakdtdrdfymsake
    akeyglidkvlqknvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zl3B (B:)
    diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
    dtmnfirpdvsticigqaaamgafllscgakgkrfslphsrimihqplggaqgqasdiei
    isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2zl3C (C:)
    mmgyipyvientdrgersydiysrllkdrivllsgeindsvassivaqllfleaedpekd
    iglyinspggvitsglsiydtmnfirpdvsticigqaaamgafllscgakgkrfslphsr
    imihqplggaqgqasdieiisneilrlkglmnsilaqnsgqsleqiakdtdrdfymsake
    akeyglidkvlqknvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zl3C (C:)
    diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
    dtmnfirpdvsticigqaaamgafllscgakgkrfslphsrimihqplggaqgqasdiei
    isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2zl3D (D:)
    mmgyipyvientdrgersydiysrllkdrivllsgeindsvassivaqllfleaedpekd
    iglyinspggvitsglsiydtmnfirpdvsticigqaaamgafllscgakgkrfslphsr
    imihqplggaqgqasdieiisneilrlkglmnsilaqnsgqsleqiakdtdrdfymsake
    akeyglidkvlqknvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zl3D (D:)
    diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
    dtmnfirpdvsticigqaaamgafllscgakgkrfslphsrimihqplggaqgqasdiei
    isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2zl3E (E:)
    mmgyipyvientdrgersydiysrllkdrivllsgeindsvassivaqllfleaedpekd
    iglyinspggvitsglsiydtmnfirpdvsticigqaaamgafllscgakgkrfslphsr
    imihqplggaqgqasdieiisneilrlkglmnsilaqnsgqsleqiakdtdrdfymsake
    akeyglidkvlqknvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zl3E (E:)
    diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
    dtmnfirpdvsticigqaaamgafllscgakgkrfslphsrimihqplggaqgqasdiei
    isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2zl3F (F:)
    mmgyipyvientdrgersydiysrllkdrivllsgeindsvassivaqllfleaedpekd
    iglyinspggvitsglsiydtmnfirpdvsticigqaaamgafllscgakgkrfslphsr
    imihqplggaqgqasdieiisneilrlkglmnsilaqnsgqsleqiakdtdrdfymsake
    akeyglidkvlqknvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zl3F (F:)
    diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
    dtmnfirpdvsticigqaaamgafllscgakgkrfslphsrimihqplggaqgqasdiei
    isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2zl3G (G:)
    mmgyipyvientdrgersydiysrllkdrivllsgeindsvassivaqllfleaedpekd
    iglyinspggvitsglsiydtmnfirpdvsticigqaaamgafllscgakgkrfslphsr
    imihqplggaqgqasdieiisneilrlkglmnsilaqnsgqsleqiakdtdrdfymsake
    akeyglidkvlqknvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zl3G (G:)
    diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
    dtmnfirpdvsticigqaaamgafllscgakgkrfslphsrimihqplggaqgqasdiei
    isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2zl3H (H:)
    mmgyipyvientdrgersydiysrllkdrivllsgeindsvassivaqllfleaedpekd
    iglyinspggvitsglsiydtmnfirpdvsticigqaaamgafllscgakgkrfslphsr
    imihqplggaqgqasdieiisneilrlkglmnsilaqnsgqsleqiakdtdrdfymsake
    akeyglidkvlqknvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zl3H (H:)
    diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
    dtmnfirpdvsticigqaaamgafllscgakgkrfslphsrimihqplggaqgqasdiei
    isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2zl3I (I:)
    mmgyipyvientdrgersydiysrllkdrivllsgeindsvassivaqllfleaedpekd
    iglyinspggvitsglsiydtmnfirpdvsticigqaaamgafllscgakgkrfslphsr
    imihqplggaqgqasdieiisneilrlkglmnsilaqnsgqsleqiakdtdrdfymsake
    akeyglidkvlqknvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zl3I (I:)
    diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
    dtmnfirpdvsticigqaaamgafllscgakgkrfslphsrimihqplggaqgqasdiei
    isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2zl3J (J:)
    mmgyipyvientdrgersydiysrllkdrivllsgeindsvassivaqllfleaedpekd
    iglyinspggvitsglsiydtmnfirpdvsticigqaaamgafllscgakgkrfslphsr
    imihqplggaqgqasdieiisneilrlkglmnsilaqnsgqsleqiakdtdrdfymsake
    akeyglidkvlqknvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zl3J (J:)
    diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
    dtmnfirpdvsticigqaaamgafllscgakgkrfslphsrimihqplggaqgqasdiei
    isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlq
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2zl3K (K:)
    mmgyipyvientdrgersydiysrllkdrivllsgeindsvassivaqllfleaedpekd
    iglyinspggvitsglsiydtmnfirpdvsticigqaaamgafllscgakgkrfslphsr
    imihqplggaqgqasdieiisneilrlkglmnsilaqnsgqsleqiakdtdrdfymsake
    akeyglidkvlqknvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zl3K (K:)
    diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
    dtmnfirpdvsticigqaaamgafllscgakgkrfslphsrimihqplggaqgqasdiei
    isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2zl3L (L:)
    mmgyipyvientdrgersydiysrllkdrivllsgeindsvassivaqllfleaedpekd
    iglyinspggvitsglsiydtmnfirpdvsticigqaaamgafllscgakgkrfslphsr
    imihqplggaqgqasdieiisneilrlkglmnsilaqnsgqsleqiakdtdrdfymsake
    akeyglidkvlqknvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zl3L (L:)
    diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
    dtmnfirpdvsticigqaaamgafllscgakgkrfslphsrimihqplggaqgqasdiei
    isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlq
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2zl3M (M:)
    mmgyipyvientdrgersydiysrllkdrivllsgeindsvassivaqllfleaedpekd
    iglyinspggvitsglsiydtmnfirpdvsticigqaaamgafllscgakgkrfslphsr
    imihqplggaqgqasdieiisneilrlkglmnsilaqnsgqsleqiakdtdrdfymsake
    akeyglidkvlqknvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zl3M (M:)
    diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
    dtmnfirpdvsticigqaaamgafllscgakgkrfslphsrimihqplggaqgqasdiei
    isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlq
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2zl3N (N:)
    mmgyipyvientdrgersydiysrllkdrivllsgeindsvassivaqllfleaedpekd
    iglyinspggvitsglsiydtmnfirpdvsticigqaaamgafllscgakgkrfslphsr
    imihqplggaqgqasdieiisneilrlkglmnsilaqnsgqsleqiakdtdrdfymsake
    akeyglidkvlqknvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2zl3N (N:)
    diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
    dtmnfirpdvsticigqaaamgafllscgakgkrfslphsrimihqplggaqgqasdiei
    isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlq