Class a: All alpha proteins [46456] (284 folds) |
Fold a.38: HLH-like [47458] (2 superfamilies) 4-helices; bundle, closed, left-handed twist; 2 crossover connections |
Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (1 family) dimer of two identical helix-loop-helix subunits |
Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (8 proteins) |
Protein Max protein [47461] (2 species) BHLHZ region; contains leucine-zipper motif |
Species Human (Homo sapiens) [TaxId:9606] [47462] (4 PDB entries) |
Domain d1hlob_: 1hlo B: [17129] protein/DNA complex |
PDB Entry: 1hlo (more details), 2.8 Å
SCOPe Domain Sequences for d1hlob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hlob_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} sdadkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknh thqqdiddlkrqn
Timeline for d1hlob_: