PDB entry 1hlo

View 1hlo on RCSB PDB site
Description: the crystal structure of an intact human max-DNA complex: new insights into mechanisms of transcriptional control
Class: transcription/DNA
Keywords: transcriptional regulation, DNA binding, complex (transcription factor max/DNA), transcription/DNA complex
Deposited on 1997-09-10, released 1997-10-27
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.213
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (transcription factor max)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1hloa_
  • Chain 'B':
    Compound: protein (transcription factor max)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1hlob_
  • Chain 'C':
    Compound: DNA (5'-d(*cp*ap*cp*cp*ap*cp*gp*tp*gp*gp*t)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*ap*cp*cp*ap*cp*gp*tp*gp*gp*tp*g)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hloA (A:)
    nddievesdadkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiq
    ymrrknhthqqdiddlkrqn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hloB (B:)
    nddievesdadkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiq
    ymrrknhthqqdiddlkrqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hloB (B:)
    sdadkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknh
    thqqdiddlkrqn
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.