SCOPe 2.04: Domain d1uxda_: 1uxd A:

Lineage for d1uxda_ (1uxd A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
   lacks the first helix of canonical fold
   3 helices; bundle, partly opened, right-handed twist

6. Protein Fructose repressor (FruR), N-terminal domain [47443] (1 species)

7. Species Escherichia coli [TaxId:562] [47444] (2 PDB entries)

8. Domain d1uxda_: 1uxd A: [17118]

Details for d1uxda_

PDB Entry: 1uxd

PDB Description: fructose repressor dna-binding domain, nmr, 34 structures

PDB Compounds: (A:) fructose repressor

SCOPe Domain Sequences for d1uxda_:

Sequence; same for both SEQRES and ATOM records:

>d1uxda_ a.35.1.5 (A:) Fructose repressor (FruR), N-terminal domain {Escherichia coli [TaxId: 562]}
mkldeiarlagvsrttasyvingkakqyrvsdktvekvmavvrehnyhpnavaaglrlq

Timeline for d1uxda_:

• d1uxda_ first appeared (with stable ids) in SCOP 1.55, called d1uxd__
  
• d1uxda_ appears in SCOPe 2.03
  
• d1uxda_ appears in SCOPe 2.05
  
• d1uxda_ appears in the current release, SCOPe 2.08, called d1uxda1