Lineage for d1uxda1 (1uxd A:1-57)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709593Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
    lacks the first helix of canonical fold
    3 helices; bundle, partly opened, right-handed twist
  6. 2709594Protein Fructose repressor (FruR), N-terminal domain [47443] (1 species)
  7. 2709595Species Escherichia coli [TaxId:562] [47444] (2 PDB entries)
  8. 2709597Domain d1uxda1: 1uxd A:1-57 [17118]
    Other proteins in same PDB: d1uxda2

Details for d1uxda1

PDB Entry: 1uxd (more details)

PDB Description: fructose repressor dna-binding domain, nmr, 34 structures
PDB Compounds: (A:) fructose repressor

SCOPe Domain Sequences for d1uxda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uxda1 a.35.1.5 (A:1-57) Fructose repressor (FruR), N-terminal domain {Escherichia coli [TaxId: 562]}
mkldeiarlagvsrttasyvingkakqyrvsdktvekvmavvrehnyhpnavaaglr

SCOPe Domain Coordinates for d1uxda1:

Click to download the PDB-style file with coordinates for d1uxda1.
(The format of our PDB-style files is described here.)

Timeline for d1uxda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uxda2