SCOPe 2.07: Domain d1uxda1: 1uxd A:1-57

Lineage for d1uxda1 (1uxd A:1-57)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 protein domains)
   lacks the first helix of canonical fold
   3 helices; bundle, partly opened, right-handed twist

6. Protein Fructose repressor (FruR), N-terminal domain [47443] (1 species)

7. Species Escherichia coli [TaxId:562] [47444] (2 PDB entries)

8. Domain d1uxda1: 1uxd A:1-57 [17118]
   Other proteins in same PDB: d1uxda2

Details for d1uxda1

PDB Entry: 1uxd

PDB Description: fructose repressor dna-binding domain, nmr, 34 structures

PDB Compounds: (A:) fructose repressor

SCOPe Domain Sequences for d1uxda1:

Sequence; same for both SEQRES and ATOM records:

>d1uxda1 a.35.1.5 (A:1-57) Fructose repressor (FruR), N-terminal domain {Escherichia coli [TaxId: 562]}
mkldeiarlagvsrttasyvingkakqyrvsdktvekvmavvrehnyhpnavaaglr

Timeline for d1uxda1:

• d1uxda1 first appeared (with stable ids) in SCOP 1.55, called d1uxd__
  
• d1uxda1 appears in SCOPe 2.06