![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
![]() | Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins) lacks the first helix of canonical fold 3 helices; bundle, partly opened, right-handed twist |
![]() | Protein Fructose repressor (FruR), N-terminal domain [47443] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [47444] (2 PDB entries) |
![]() | Domain d1uxda1: 1uxd A:1-57 [17118] Other proteins in same PDB: d1uxda2 |
PDB Entry: 1uxd (more details)
SCOPe Domain Sequences for d1uxda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uxda1 a.35.1.5 (A:1-57) Fructose repressor (FruR), N-terminal domain {Escherichia coli [TaxId: 562]} mkldeiarlagvsrttasyvingkakqyrvsdktvekvmavvrehnyhpnavaaglr
Timeline for d1uxda1: