Lineage for d1uxd__ (1uxd -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2993Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
  4. 2994Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) (S)
  5. 3087Family a.35.1.5: Bacterial repressors [47438] (3 proteins)
  6. 3088Protein Fructose repressor (FruR), N-terminal domain [47443] (1 species)
  7. 3089Species Escherichia coli [TaxId:562] [47444] (2 PDB entries)
  8. 3090Domain d1uxd__: 1uxd - [17118]

Details for d1uxd__

PDB Entry: 1uxd (more details)

PDB Description: fructose repressor dna-binding domain, nmr, 34 structures

SCOP Domain Sequences for d1uxd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uxd__ a.35.1.5 (-) Fructose repressor (FruR), N-terminal domain {Escherichia coli}
mkldeiarlagvsrttasyvingkakqyrvsdktvekvmavvrehnyhpnavaaglrlq

SCOP Domain Coordinates for d1uxd__:

Click to download the PDB-style file with coordinates for d1uxd__.
(The format of our PDB-style files is described here.)

Timeline for d1uxd__: