| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
| Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins) lacks the first helix of canonical fold 3 helices; bundle, partly opened, right-handed twist |
| Protein Lac repressor (LacR), N-terminal domain [47441] (1 species) |
| Species Escherichia coli [TaxId:562] [47442] (14 PDB entries) |
| Domain d1cjgb_: 1cjg B: [17113] protein/DNA complex |
PDB Entry: 1cjg (more details)
SCOPe Domain Sequences for d1cjgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cjgb_ a.35.1.5 (B:) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]}
mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
sl
Timeline for d1cjgb_: