SCOPe 2.08: Domain d1cjgb_: 1cjg B:

Lineage for d1cjgb_ (1cjg B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
   lacks the first helix of canonical fold
   3 helices; bundle, partly opened, right-handed twist

6. Protein Lac repressor (LacR), N-terminal domain [47441] (1 species)

7. Species Escherichia coli [TaxId:562] [47442] (14 PDB entries)

8. Domain d1cjgb_: 1cjg B: [17113]
   protein/DNA complex

Details for d1cjgb_

PDB Entry: 1cjg

PDB Description: nmr structure of lac repressor hp62-dna complex

PDB Compounds: (B:) protein (lac repressor)

SCOPe Domain Sequences for d1cjgb_:

Sequence; same for both SEQRES and ATOM records:

>d1cjgb_ a.35.1.5 (B:) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]}
mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
sl

Timeline for d1cjgb_:

• d1cjgb_ first appeared (with stable ids) in SCOP 1.55
  
• d1cjgb_ appears in SCOPe 2.07