PDB entry 1cjg

View 1cjg on RCSB PDB site
Description: nmr structure of lac repressor hp62-DNA complex
Class: transcription/DNA
Keywords: transcription regulation, lac operon, lac repressor, headpiece, lac operator, transcription/DNA complex
Deposited on 1999-04-14, released 2000-01-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (lac repressor)
    Species: Escherichia coli [TaxId:562]
    Gene: LAC I, THE PART ENCODING THE 62 N-TERMINAL AMINOACIDS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cjga_
  • Chain 'B':
    Compound: protein (lac repressor)
    Species: Escherichia coli [TaxId:562]
    Gene: LAC I, THE PART ENCODING THE 62 N-TERMINAL AMINOACIDS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cjgb_
  • Chain 'C':
    Compound: DNA (5'-d(*gp*ap*ap*tp*tp*gp*tp*gp*ap*gp*cp*gp*cp*tp*cp*ap*cp*ap*ap*tp*tp*c)-3')
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: DNA (5'-d(*gp*ap*ap*tp*tp*gp*tp*gp*ap*gp*cp*gp*cp*tp*cp*ap*cp*ap*ap*tp*tp*c)-3')
    Species: synthetic, synthetic

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cjgA (A:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
    sl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cjgB (B:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
    sl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.