Lineage for d1cjgb_ (1cjg B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2993Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
  4. 2994Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) (S)
  5. 3087Family a.35.1.5: Bacterial repressors [47438] (3 proteins)
  6. 3092Protein Lac repressor (LacR), N-terminal domain [47441] (1 species)
  7. 3093Species Escherichia coli [TaxId:562] [47442] (6 PDB entries)
  8. 3101Domain d1cjgb_: 1cjg B: [17113]

Details for d1cjgb_

PDB Entry: 1cjg (more details)

PDB Description: nmr structure of lac repressor hp62-dna complex

SCOP Domain Sequences for d1cjgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjgb_ a.35.1.5 (B:) Lac repressor (LacR), N-terminal domain {Escherichia coli}
mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
sl

SCOP Domain Coordinates for d1cjgb_:

Click to download the PDB-style file with coordinates for d1cjgb_.
(The format of our PDB-style files is described here.)

Timeline for d1cjgb_:

3101
d1cjgb_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1cjga_