Lineage for d2z8ha_ (2z8h A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1202046Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1202047Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1202163Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 1202164Protein automated matches [190710] (2 species)
    not a true protein
  7. 1202198Species Mouse (Mus musculus) [TaxId:10090] [188594] (1 PDB entry)
  8. 1202199Domain d2z8ha_: 2z8h A: [171104]
    automated match to d3bimb1

Details for d2z8ha_

PDB Entry: 2z8h (more details), 2.5 Å

PDB Description: Structure of mouse Bach1 BTB domain
PDB Compounds: (A:) Transcription regulator protein BACH1

SCOPe Domain Sequences for d2z8ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z8ha_ d.42.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
phmsvsesavfayessvhstnvllslndqrkkdvlcdvtvlvegqrfrahrsvlaacssy
fhsrivgqtdaeltvtlpeevtvkgfepliqfaytaklilskdnvdevcrcveflsvhni
eescfqflkfkfldsts

SCOPe Domain Coordinates for d2z8ha_:

Click to download the PDB-style file with coordinates for d2z8ha_.
(The format of our PDB-style files is described here.)

Timeline for d2z8ha_: