Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.0: automated matches [191460] (1 protein) not a true family |
Protein automated matches [190710] (5 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188594] (2 PDB entries) |
Domain d2z8ha1: 2z8h A:1-135 [171104] Other proteins in same PDB: d2z8ha2 automated match to d3bimb1 |
PDB Entry: 2z8h (more details), 2.5 Å
SCOPe Domain Sequences for d2z8ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z8ha1 d.42.1.0 (A:1-135) automated matches {Mouse (Mus musculus) [TaxId: 10090]} msvsesavfayessvhstnvllslndqrkkdvlcdvtvlvegqrfrahrsvlaacssyfh srivgqtdaeltvtlpeevtvkgfepliqfaytaklilskdnvdevcrcveflsvhniee scfqflkfkfldsts
Timeline for d2z8ha1: