Lineage for d2z8ha1 (2z8h A:1-135)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2945442Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2945443Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2945784Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 2945785Protein automated matches [190710] (5 species)
    not a true protein
  7. 2945939Species Mouse (Mus musculus) [TaxId:10090] [188594] (2 PDB entries)
  8. 2945940Domain d2z8ha1: 2z8h A:1-135 [171104]
    Other proteins in same PDB: d2z8ha2
    automated match to d3bimb1

Details for d2z8ha1

PDB Entry: 2z8h (more details), 2.5 Å

PDB Description: Structure of mouse Bach1 BTB domain
PDB Compounds: (A:) Transcription regulator protein BACH1

SCOPe Domain Sequences for d2z8ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z8ha1 d.42.1.0 (A:1-135) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
msvsesavfayessvhstnvllslndqrkkdvlcdvtvlvegqrfrahrsvlaacssyfh
srivgqtdaeltvtlpeevtvkgfepliqfaytaklilskdnvdevcrcveflsvhniee
scfqflkfkfldsts

SCOPe Domain Coordinates for d2z8ha1:

Click to download the PDB-style file with coordinates for d2z8ha1.
(The format of our PDB-style files is described here.)

Timeline for d2z8ha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2z8ha2