![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
![]() | Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
![]() | Family d.42.1.0: automated matches [191460] (1 protein) not a true family |
![]() | Protein automated matches [190710] (3 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188594] (2 PDB entries) |
![]() | Domain d2z8ha_: 2z8h A: [171104] automated match to d3bimb1 |
PDB Entry: 2z8h (more details), 2.5 Å
SCOPe Domain Sequences for d2z8ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z8ha_ d.42.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} phmsvsesavfayessvhstnvllslndqrkkdvlcdvtvlvegqrfrahrsvlaacssy fhsrivgqtdaeltvtlpeevtvkgfepliqfaytaklilskdnvdevcrcveflsvhni eescfqflkfkfldsts
Timeline for d2z8ha_: