Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (49 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [188268] (2 PDB entries) |
Domain d2z0za_: 2z0z A: [170964] automated match to d1yrea1 complexed with so4 |
PDB Entry: 2z0z (more details), 2 Å
SCOPe Domain Sequences for d2z0za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z0za_ d.108.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mwafperfegrhvrleplalahlpaflrhydpevyrflsrapvapteealrahlegllge pgrvnwailfgkevagrisviapepehaklelgtmlfkpfwgspankeakylllrhafev lraervqfkvdlrnersqralealgavregvlrknrrlpdgafrddvvysvlkeewpgvk arlearlygasgnp
Timeline for d2z0za_: