Lineage for d2z0za_ (2z0z A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969496Species Thermus thermophilus HB8 [TaxId:300852] [188268] (2 PDB entries)
  8. 2969497Domain d2z0za_: 2z0z A: [170964]
    automated match to d1yrea1
    complexed with so4

Details for d2z0za_

PDB Entry: 2z0z (more details), 2 Å

PDB Description: Crystal structure of putative acetyltransferase
PDB Compounds: (A:) Putative uncharacterized protein TTHA1799

SCOPe Domain Sequences for d2z0za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z0za_ d.108.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mwafperfegrhvrleplalahlpaflrhydpevyrflsrapvapteealrahlegllge
pgrvnwailfgkevagrisviapepehaklelgtmlfkpfwgspankeakylllrhafev
lraervqfkvdlrnersqralealgavregvlrknrrlpdgafrddvvysvlkeewpgvk
arlearlygasgnp

SCOPe Domain Coordinates for d2z0za_:

Click to download the PDB-style file with coordinates for d2z0za_.
(The format of our PDB-style files is described here.)

Timeline for d2z0za_: