PDB entry 2z0z

View 2z0z on RCSB PDB site
Description: Crystal structure of putative acetyltransferase
Class: transferase
Keywords: alpha/beta protein, TRANSFERASE, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-05-07, released 2007-11-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.17
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein TTHA1799
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2z0za_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z0zA (A:)
    mwafperfegrhvrleplalahlpaflrhydpevyrflsrapvapteealrahlegllge
    pgrvnwailfgkevagrisviapepehaklelgtmlfkpfwgspankeakylllrhafev
    lraervqfkvdlrnersqralealgavregvlrknrrlpdgafrddvvysvlkeewpgvk
    arlearlygasgnp