Lineage for d2yzhc_ (2yzh C:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1169725Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1169726Protein automated matches [190056] (50 species)
    not a true protein
  7. 1169730Species Aquifex aeolicus [TaxId:224324] [188265] (1 PDB entry)
  8. 1169733Domain d2yzhc_: 2yzh C: [170942]
    automated match to d1psqa_
    complexed with so4

Details for d2yzhc_

PDB Entry: 2yzh (more details), 1.85 Å

PDB Description: Crystal structure of peroxiredoxin-like protein from Aquifex aeolicus
PDB Compounds: (C:) Probable thiol peroxidase

SCOPe Domain Sequences for d2yzhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yzhc_ c.47.1.0 (C:) automated matches {Aquifex aeolicus [TaxId: 224324]}
ghmartvnlkgnpvtlvgpelkvgdrapeavvvtkdlqekivggakdvvqviitvpsldt
pvcetetkkfneimagmegvdvtvvsmdlpfaqkrfcesfniqnvtvasdfryrdmekyg
vligegalkgilaravfiidkegkvayvqlvpeiteepnydevvnkvkel

SCOPe Domain Coordinates for d2yzhc_:

Click to download the PDB-style file with coordinates for d2yzhc_.
(The format of our PDB-style files is described here.)

Timeline for d2yzhc_: