Lineage for d1psqa_ (1psq A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1169030Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 1169199Protein Probable thiol peroxidase PsaD [89710] (1 species)
  7. 1169200Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [89711] (1 PDB entry)
  8. 1169201Domain d1psqa_: 1psq A: [88283]
    structural genomics

Details for d1psqa_

PDB Entry: 1psq (more details), 2.3 Å

PDB Description: structure of a probable thiol peroxidase from streptococcus pneumoniae
PDB Compounds: (A:) Probable thiol peroxidase

SCOPe Domain Sequences for d1psqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mvtflgnpvsftgkqlqvgdkaldfsltttdlskksladfdgkkkvlsvvpsidtgicst
qtrrfneelagldntvvltvsmdlpfaqkrwcgaegldnaimlsdyfdhsfgrdyallin
ewhllaravfvldtdntiryveyvdninsepnfeaaiaaakal

SCOPe Domain Coordinates for d1psqa_:

Click to download the PDB-style file with coordinates for d1psqa_.
(The format of our PDB-style files is described here.)

Timeline for d1psqa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1psqb_