| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
| Protein Probable thiol peroxidase PsaD [89710] (1 species) |
| Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [89711] (1 PDB entry) |
| Domain d1psqa_: 1psq A: [88283] structural genomics |
PDB Entry: 1psq (more details), 2.3 Å
SCOPe Domain Sequences for d1psqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mvtflgnpvsftgkqlqvgdkaldfsltttdlskksladfdgkkkvlsvvpsidtgicst
qtrrfneelagldntvvltvsmdlpfaqkrwcgaegldnaimlsdyfdhsfgrdyallin
ewhllaravfvldtdntiryveyvdninsepnfeaaiaaakal
Timeline for d1psqa_: