Lineage for d1dwke1 (1dwk E:1-86)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709508Family a.35.1.4: Cyanase N-terminal domain [47435] (2 proteins)
    probably does not bind to DNA
  6. 2709509Protein Cyanase N-terminal domain [47436] (1 species)
  7. 2709510Species Escherichia coli [TaxId:562] [47437] (2 PDB entries)
  8. 2709525Domain d1dwke1: 1dwk E:1-86 [17079]
    Other proteins in same PDB: d1dwka2, d1dwkb2, d1dwkc2, d1dwkd2, d1dwke2, d1dwkf2, d1dwkg2, d1dwkh2, d1dwki2, d1dwkj2
    complexed with oxl, so4

Details for d1dwke1

PDB Entry: 1dwk (more details), 1.65 Å

PDB Description: structure of cyanase with the di-anion oxalate bound at the enzyme active site
PDB Compounds: (E:) cyanate hydratase

SCOPe Domain Sequences for d1dwke1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dwke1 a.35.1.4 (E:1-86) Cyanase N-terminal domain {Escherichia coli [TaxId: 562]}
miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
vgakldldedsilllqmiplrgcidd

SCOPe Domain Coordinates for d1dwke1:

Click to download the PDB-style file with coordinates for d1dwke1.
(The format of our PDB-style files is described here.)

Timeline for d1dwke1: