PDB entry 1dwk

View 1dwk on RCSB PDB site
Description: structure of cyanase with the di-anion oxalate bound at the enzyme active site
Class: lyase
Keywords: lyase, cyanate degradation, psi, protein structure initiative, midwest center for structural genomics, mcsg
Deposited on 1999-12-07, released 2000-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • modified residue (0)
      • modified residue (76)
      • modified residue (93)
      • modified residue (99)
    Domains in SCOPe 2.07: d1dwka1, d1dwka2
  • Chain 'B':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • modified residue (0)
      • modified residue (76)
      • modified residue (93)
      • modified residue (99)
    Domains in SCOPe 2.07: d1dwkb1, d1dwkb2
  • Chain 'C':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • modified residue (0)
      • modified residue (76)
      • modified residue (93)
      • modified residue (99)
    Domains in SCOPe 2.07: d1dwkc1, d1dwkc2
  • Chain 'D':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • modified residue (0)
      • modified residue (76)
      • modified residue (93)
      • modified residue (99)
    Domains in SCOPe 2.07: d1dwkd1, d1dwkd2
  • Chain 'E':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • modified residue (0)
      • modified residue (76)
      • modified residue (93)
      • modified residue (99)
    Domains in SCOPe 2.07: d1dwke1, d1dwke2
  • Chain 'F':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • modified residue (0)
      • modified residue (76)
      • modified residue (93)
      • modified residue (99)
    Domains in SCOPe 2.07: d1dwkf1, d1dwkf2
  • Chain 'G':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • modified residue (0)
      • modified residue (76)
      • modified residue (93)
      • modified residue (99)
    Domains in SCOPe 2.07: d1dwkg1, d1dwkg2
  • Chain 'H':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • modified residue (0)
      • modified residue (76)
      • modified residue (93)
      • modified residue (99)
    Domains in SCOPe 2.07: d1dwkh1, d1dwkh2
  • Chain 'I':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • modified residue (0)
      • modified residue (76)
      • modified residue (93)
      • modified residue (99)
    Domains in SCOPe 2.07: d1dwki1, d1dwki2
  • Chain 'J':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • modified residue (0)
      • modified residue (76)
      • modified residue (93)
      • modified residue (99)
    Domains in SCOPe 2.07: d1dwkj1, d1dwkj2
  • Heterogens: SO4, OXL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dwkA (A:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dwkB (B:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dwkC (C:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dwkD (D:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dwkE (E:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dwkF (F:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dwkG (G:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dwkH (H:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dwkI (I:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dwkJ (J:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf