Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily) intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta |
Superfamily d.72.1: Cyanase C-terminal domain [55234] (2 families) automatically mapped to Pfam PF02560 |
Family d.72.1.1: Cyanase C-terminal domain [55235] (2 proteins) active form is a decamer formed by five dimers |
Protein Cyanase C-terminal domain [55236] (1 species) |
Species Escherichia coli [TaxId:562] [55237] (2 PDB entries) |
Domain d1dwkh2: 1dwk H:87-156 [39613] Other proteins in same PDB: d1dwka1, d1dwkb1, d1dwkc1, d1dwkd1, d1dwke1, d1dwkf1, d1dwkg1, d1dwkh1, d1dwki1, d1dwkj1 complexed with oxl, so4 |
PDB Entry: 1dwk (more details), 1.65 Å
SCOPe Domain Sequences for d1dwkh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dwkh2 d.72.1.1 (H:87-156) Cyanase C-terminal domain {Escherichia coli [TaxId: 562]} riptdptmyrfyemlqvygttlkalvhekfgdgiisainfkldvkkvadpeggeravitl dgkylptkpf
Timeline for d1dwkh2: