Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein Archaeal fructose 1,6-bisphosphate aldolase [102088] (1 species) |
Species Thermoproteus tenax [TaxId:2271] [102089] (5 PDB entries) |
Domain d2ycee_: 2yce E: [170744] automated match to d2ycea1 complexed with m2p |
PDB Entry: 2yce (more details), 1.93 Å
SCOPe Domain Sequences for d2ycee_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ycee_ c.1.10.1 (E:) Archaeal fructose 1,6-bisphosphate aldolase {Thermoproteus tenax [TaxId: 2271]} nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk mfeelarikrdavkfdlplvvwsfprggkvvnetapeivayaarialelgsdamkikytg dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk faralaelvyggkkl
Timeline for d2ycee_: