Lineage for d2ycee1 (2yce E:3-252)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 972170Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 972171Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 972190Protein Archaeal fructose 1,6-bisphosphate aldolase [102088] (1 species)
  7. 972191Species Thermoproteus tenax [TaxId:2271] [102089] (5 PDB entries)
  8. 972207Domain d2ycee1: 2yce E:3-252 [170744]
    automatically matched to 1W8R A:3-252
    complexed with m2p

Details for d2ycee1

PDB Entry: 2yce (more details), 1.93 Å

PDB Description: structure of an archaeal fructose-1,6-bisphosphate aldolase with the catalytic lys covalently bound to the carbinolamine intermediate of the substrate.
PDB Compounds: (E:) fructose-bisphosphate aldolase class 1

SCOPe Domain Sequences for d2ycee1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ycee1 c.1.10.1 (E:3-252) Archaeal fructose 1,6-bisphosphate aldolase {Thermoproteus tenax [TaxId: 2271]}
nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
mfeelarikrdavkfdlplvvwsfprggkvvnetapeivayaarialelgsdamkikytg
dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
faralaelvy

SCOPe Domain Coordinates for d2ycee1:

Click to download the PDB-style file with coordinates for d2ycee1.
(The format of our PDB-style files is described here.)

Timeline for d2ycee1: