SCOPe 2.01: Domain d2orca_: 2orc A:

Lineage for d2orca_ (2orc A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.2: Phage repressors [47419] (7 proteins)
   consists of different sequence families of HTH repressors of phage origins

6. Protein cro lambda repressor [47428] (1 species)
   the fourth helix is replaced with a beta hairpin
   3 helices; folded leaf, opened

7. Species Bacteriophage lambda [TaxId:10710] [47429] (11 PDB entries)

8. Domain d2orca_: 2orc A: [17060]
   insertion mutant k56-[dgevk]
   mutant

Details for d2orca_

PDB Entry: 2orc

PDB Description: cro repressor insertion mutant k56-[dgevk], nmr, 32 structures

PDB Compounds: (A:) cro repressor

SCOPe Domain Sequences for d2orca_:

Sequence; same for both SEQRES and ATOM records:

>d2orca_ a.35.1.2 (A:) cro lambda repressor {Bacteriophage lambda [TaxId: 10710]}
meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkdgev
kpfpsnkktta

Timeline for d2orca_:

• d2orca_ first appeared (with stable ids) in SCOP 1.55, called d2orc__
  
• d2orca_ appears in SCOP 1.75
  
• d2orca_ appears in SCOPe 2.02
  
• d2orca_ appears in the current release, SCOPe 2.08