Lineage for d2orc__ (2orc -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2993Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
  4. 2994Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) (S)
  5. 3006Family a.35.1.2: Phage repressors [47419] (6 proteins)
  6. 3025Protein cro lambda repressor [47428] (1 species)
  7. 3026Species Bacteriophage lambda (Escherichia coli) [TaxId:10710] [47429] (9 PDB entries)
  8. 3044Domain d2orc__: 2orc - [17060]

Details for d2orc__

PDB Entry: 2orc (more details)

PDB Description: cro repressor insertion mutant k56-[dgevk], nmr, 32 structures

SCOP Domain Sequences for d2orc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2orc__ a.35.1.2 (-) cro lambda repressor {Bacteriophage lambda (Escherichia coli)}
meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkdgev
kpfpsnkktta

SCOP Domain Coordinates for d2orc__:

Click to download the PDB-style file with coordinates for d2orc__.
(The format of our PDB-style files is described here.)

Timeline for d2orc__: