PDB entry 2orc

View 2orc on RCSB PDB site
Description: cro repressor insertion mutant k56-[dgevk], nmr, 32 structures
Class: gene regulating protein
Keywords: gene regulating protein
Deposited on 1998-01-20, released 1998-05-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.99 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cro repressor
    Species: Enterobacteria phage lambda [TaxId:10710]
    Gene: CRO MUTANT K56-[DGEVK]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03040 (0-70)
      • insertion (53-55)
      • insertion (55)
      • insertion (55)
    Domains in SCOPe 2.01: d2orca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2orcA (A:)
    meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkdgev
    kpfpsnkktta