Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins) |
Protein automated matches [190670] (7 species) not a true protein |
Species Synechococcus elongatus PCC 7942 [TaxId:1140] [189437] (4 PDB entries) |
Domain d2xule_: 2xul E: [170404] Other proteins in same PDB: d2xula2, d2xulb2, d2xulc2, d2xuld2, d2xulf2 automated match to d1qy7a_ complexed with akg, atp, mg |
PDB Entry: 2xul (more details), 2.2 Å
SCOPe Domain Sequences for d2xule_:
Sequence, based on SEQRES records: (download)
>d2xule_ d.58.5.1 (E:) automated matches {Synechococcus elongatus PCC 7942 [TaxId: 1140]} mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadai
>d2xule_ d.58.5.1 (E:) automated matches {Synechococcus elongatus PCC 7942 [TaxId: 1140]} mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteseytveflqklkleiv vedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadai
Timeline for d2xule_: