SCOPe 2.08: Domain d2xuld1: 2xul D:1-112

Lineage for d2xuld1 (2xul D:1-112)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)

6. Protein automated matches [190670] (7 species)
   not a true protein

7. Species Synechococcus elongatus PCC 7942 [TaxId:1140] [189437] (4 PDB entries)

8. Domain d2xuld1: 2xul D:1-112 [170403]
   Other proteins in same PDB: d2xula2, d2xulb2, d2xulc2, d2xuld2, d2xulf2
   automated match to d1qy7a_
   complexed with akg, atp, mg

Details for d2xuld1

PDB Entry: 2xul, 2.2 Å

PDB Description: structure of pii from synechococcus elongatus in complex with 2-oxoglutarate at high 2-og concentrations

PDB Compounds: (D:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d2xuld1:

Sequence, based on SEQRES records:

>d2xuld1 d.58.5.1 (D:1-112) automated matches {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadai

Sequence, based on observed residues (ATOM records):

>d2xuld1 d.58.5.1 (D:1-112) automated matches {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqytveflqklkleivveda
qvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadai

Timeline for d2xuld1:

• d2xuld1 first appeared in SCOPe 2.01, called d2xuld_
  
• d2xuld1 appears in SCOPe 2.07