Lineage for d2xrxd_ (2xrx D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2936608Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 2936664Protein automated matches [190223] (5 species)
    not a true protein
  7. 2936665Species Burkholderia xenovorans [TaxId:266265] [189543] (9 PDB entries)
  8. 2936721Domain d2xrxd_: 2xrx D: [170336]
    Other proteins in same PDB: d2xrxa1, d2xrxa2, d2xrxc1, d2xrxc2, d2xrxe1, d2xrxe2, d2xrxg1, d2xrxg2, d2xrxi1, d2xrxi2, d2xrxk1, d2xrxk2, d2xrxm1, d2xrxm2, d2xrxo1, d2xrxo2, d2xrxq1, d2xrxq2, d2xrxs1, d2xrxs2, d2xrxu1, d2xrxu2, d2xrxw1, d2xrxw2
    automated match to d1wqlb1
    complexed with bnl, fe2, fes

Details for d2xrxd_

PDB Entry: 2xrx (more details), 2.42 Å

PDB Description: crystal structure of biphenyl dioxygenase in complex with biphenyl from burkholderia xenovorans lb400
PDB Compounds: (D:) Biphenyl dioxygenase subunit beta

SCOPe Domain Sequences for d2xrxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xrxd_ d.17.4.4 (D:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
ffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmir
egeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdt
fevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmf
f

SCOPe Domain Coordinates for d2xrxd_:

Click to download the PDB-style file with coordinates for d2xrxd_.
(The format of our PDB-style files is described here.)

Timeline for d2xrxd_: