Lineage for d2xrxu1 (2xrx U:18-179)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782333Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2782334Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2782562Family b.33.1.0: automated matches [191455] (1 protein)
    not a true family
  6. 2782563Protein automated matches [190701] (13 species)
    not a true protein
  7. 2782569Species Burkholderia xenovorans [TaxId:266265] [226023] (9 PDB entries)
  8. 2782634Domain d2xrxu1: 2xrx U:18-179 [198658]
    Other proteins in same PDB: d2xrxa2, d2xrxb_, d2xrxc2, d2xrxd_, d2xrxe2, d2xrxf_, d2xrxg2, d2xrxh_, d2xrxi2, d2xrxj_, d2xrxk2, d2xrxl_, d2xrxm2, d2xrxn_, d2xrxo2, d2xrxp_, d2xrxq2, d2xrxr_, d2xrxs2, d2xrxt_, d2xrxu2, d2xrxv_, d2xrxw2, d2xrxx_
    automated match to d1wqla1
    complexed with bnl, fe2, fes

Details for d2xrxu1

PDB Entry: 2xrx (more details), 2.42 Å

PDB Description: crystal structure of biphenyl dioxygenase in complex with biphenyl from burkholderia xenovorans lb400
PDB Compounds: (U:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d2xrxu1:

Sequence, based on SEQRES records: (download)

>d2xrxu1 b.33.1.0 (U:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvq

Sequence, based on observed residues (ATOM records): (download)

>d2xrxu1 b.33.1.0 (U:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeafdkaewgplqarvatykglvfanwdvq

SCOPe Domain Coordinates for d2xrxu1:

Click to download the PDB-style file with coordinates for d2xrxu1.
(The format of our PDB-style files is described here.)

Timeline for d2xrxu1: