| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
| Family a.35.1.2: Phage repressors [47419] (7 proteins) consists of different sequence families of HTH repressors of phage origins |
| Protein 434 C1 repressor, DNA-binding domain [47422] (1 species) |
| Species Bacteriophage 434 [TaxId:10712] [47423] (8 PDB entries) Uniprot P16117 10-62; contains a short additional helix at C-terminus |
| Domain d2or1l_: 2or1 L: [17031] protein/DNA complex |
PDB Entry: 2or1 (more details), 2.5 Å
SCOPe Domain Sequences for d2or1l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2or1l_ a.35.1.2 (L:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]}
sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
ngt
Timeline for d2or1l_: