SCOPe 2.03: Domain d2or1l_: 2or1 L:

Lineage for d2or1l_ (2or1 L:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.2: Phage repressors [47419] (7 proteins)
   consists of different sequence families of HTH repressors of phage origins

6. Protein 434 C1 repressor, DNA-binding domain [47422] (1 species)

7. Species Bacteriophage 434 [TaxId:10712] [47423] (8 PDB entries)
   Uniprot P16117 10-62; contains a short additional helix at C-terminus

8. Domain d2or1l_: 2or1 L: [17031]
   protein/DNA complex

Details for d2or1l_

PDB Entry: 2or1, 2.5 Å

PDB Description: recognition of a dna operator by the repressor of phage 434. a view at high resolution

PDB Compounds: (L:) 434 repressor

SCOPe Domain Sequences for d2or1l_:

Sequence; same for both SEQRES and ATOM records:

>d2or1l_ a.35.1.2 (L:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]}
sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
ngt

Timeline for d2or1l_:

• d2or1l_ first appeared (with stable ids) in SCOP 1.55
  
• d2or1l_ appears in SCOPe 2.02
  
• d2or1l_ appears in SCOPe 2.04
  
• d2or1l_ appears in the current release, SCOPe 2.08