SCOP 1.55: Domain d2or1l_: 2or1 L:

Lineage for d2or1l_ (2or1 L:)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families)

5. Family a.35.1.2: Phage repressors [47419] (6 proteins)

6. Protein 434 C1 repressor, DNA-binding domain [47422] (1 species)

7. Species Bacteriophage 434 (Escherichia coli) [TaxId:10712] [47423] (7 PDB entries)

8. Domain d2or1l_: 2or1 L: [17031]

Details for d2or1l_

PDB Entry: 2or1, 2.5 Å

PDB Description: recognition of a dna operator by the repressor of phage 434. a view at high resolution

SCOP Domain Sequences for d2or1l_:

Sequence; same for both SEQRES and ATOM records:

>d2or1l_ a.35.1.2 (L:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 (Escherichia coli)}
sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
ngt

Timeline for d2or1l_:

• d2or1l_ appears in SCOP 1.57
  
• d2or1l_ appears in the current release, SCOPe 2.08