![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families) ![]() automatically mapped to Pfam PF01320 |
![]() | Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins) |
![]() | Protein ImmE7 protein (Im7) [47347] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [47348] (10 PDB entries) |
![]() | Domain d1ayia_: 1ayi A: [16940] |
PDB Entry: 1ayi (more details), 2 Å
SCOPe Domain Sequences for d1ayia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ayia_ a.28.2.1 (A:) ImmE7 protein (Im7) {Escherichia coli [TaxId: 562]} melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn rddspegivkeikewraangkpgfkq
Timeline for d1ayia_: