Lineage for d1ayi__ (1ayi -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2830Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
  4. 2844Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family) (S)
  5. 2845Family a.28.2.1: Colicin E immunity proteins [47346] (3 proteins)
  6. 2846Protein ImmE7 protein (Im7) [47347] (1 species)
  7. 2847Species Escherichia coli [TaxId:562] [47348] (4 PDB entries)
  8. 2853Domain d1ayi__: 1ayi - [16940]

Details for d1ayi__

PDB Entry: 1ayi (more details), 2 Å

PDB Description: colicin e7 immunity protein im7

SCOP Domain Sequences for d1ayi__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ayi__ a.28.2.1 (-) ImmE7 protein (Im7) {Escherichia coli}
melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
rddspegivkeikewraangkpgfkq

SCOP Domain Coordinates for d1ayi__:

Click to download the PDB-style file with coordinates for d1ayi__.
(The format of our PDB-style files is described here.)

Timeline for d1ayi__: