PDB entry 1ayi

View 1ayi on RCSB PDB site
Description: colicin e7 immunity protein im7
Class: bacteriocin
Keywords: bacteriocin, e colicins, protein-protein interactions, DNAse inhibitor
Deposited on 1997-11-04, released 1998-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.178
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: colicin e immunity protein 7
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ayia_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ayiA (A:)
    melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
    rddspegivkeikewraangkpgfkqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ayiA (A:)
    melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
    rddspegivkeikewraangkpgfkq