SCOPe 2.06: Domain d2werb_: 2wer B:

Lineage for d2werb_ (2wer B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein automated matches [190229] (11 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187543] (7 PDB entries)

8. Domain d2werb_: 2wer B: [169281]
   automated match to d1ah8b_
   complexed with rdc; mutant

Details for d2werb_

PDB Entry: 2wer, 1.6 Å

PDB Description: yeast hsp90 n-terminal domain li-iv mutant with radicicol

PDB Compounds: (B:) ATP-dependent molecular chaperone hsp82

SCOPe Domain Sequences for d2werb_:

Sequence; same for both SEQRES and ATOM records:

>d2werb_ d.122.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
masetfefqaeitqlmsliintvysnkeiflreivsnasdaldkirykslsdpkqletep
dlfiritpkpeqkvleirdsgigmtkaelinnlgtiaksgtkafmealsagadvsmigqf
gvgfyslflvadrvqvisksnddeqyiwesnaggsftvtldevnerigrgtilrlflkdd
qleyleekrikevikrhsefvaypiqlvvtkeve

Timeline for d2werb_:

• d2werb_ first appeared in SCOPe 2.01
  
• d2werb_ appears in SCOPe 2.05
  
• d2werb_ appears in SCOPe 2.07
  
• d2werb_ appears in the current release, SCOPe 2.08