Lineage for d2wera_ (2wer A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212981Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2212982Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2212983Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2213185Protein automated matches [190229] (11 species)
    not a true protein
  7. 2213186Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187543] (7 PDB entries)
  8. 2213187Domain d2wera_: 2wer A: [169280]
    automated match to d1ah8b_
    complexed with rdc; mutant

Details for d2wera_

PDB Entry: 2wer (more details), 1.6 Å

PDB Description: yeast hsp90 n-terminal domain li-iv mutant with radicicol
PDB Compounds: (A:) ATP-dependent molecular chaperone hsp82

SCOPe Domain Sequences for d2wera_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wera_ d.122.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
masetfefqaeitqlmsliintvysnkeiflreivsnasdaldkirykslsdpkqletep
dlfiritpkpeqkvleirdsgigmtkaelinnlgtiaksgtkafmealsagadvsmigqf
gvgfyslflvadrvqvisksnddeqyiwesnaggsftvtldevnerigrgtilrlflkdd
qleyleekrikevikrhsefvaypiqlvvtkeve

SCOPe Domain Coordinates for d2wera_:

Click to download the PDB-style file with coordinates for d2wera_.
(The format of our PDB-style files is described here.)

Timeline for d2wera_: