PDB entry 2wer

View 2wer on RCSB PDB site
Description: yeast hsp90 n-terminal domain li-IV mutant with radicicol
Class: chaperone
Keywords: ATPase, chaperone, ATP-binding, phosphoprotein, stress response, nucleotide-binding
Deposited on 2009-04-01, released 2009-04-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-02, with a file datestamp of 2011-10-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.24471
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent molecular chaperone hsp82
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02829 (0-End)
      • engineered mutation (33-34)
    Domains in SCOPe 2.06: d2wera_
  • Chain 'B':
    Compound: ATP-dependent molecular chaperone hsp82
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02829 (0-End)
      • engineered mutation (33-34)
    Domains in SCOPe 2.06: d2werb_
  • Heterogens: RDC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2werA (A:)
    masetfefqaeitqlmsliintvysnkeiflreivsnasdaldkirykslsdpkqletep
    dlfiritpkpeqkvleirdsgigmtkaelinnlgtiaksgtkafmealsagadvsmigqf
    gvgfyslflvadrvqvisksnddeqyiwesnaggsftvtldevnerigrgtilrlflkdd
    qleyleekrikevikrhsefvaypiqlvvtkevekevpip
    

    Sequence, based on observed residues (ATOM records): (download)
    >2werA (A:)
    masetfefqaeitqlmsliintvysnkeiflreivsnasdaldkirykslsdpkqletep
    dlfiritpkpeqkvleirdsgigmtkaelinnlgtiaksgtkafmealsagadvsmigqf
    gvgfyslflvadrvqvisksnddeqyiwesnaggsftvtldevnerigrgtilrlflkdd
    qleyleekrikevikrhsefvaypiqlvvtkeve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2werB (B:)
    masetfefqaeitqlmsliintvysnkeiflreivsnasdaldkirykslsdpkqletep
    dlfiritpkpeqkvleirdsgigmtkaelinnlgtiaksgtkafmealsagadvsmigqf
    gvgfyslflvadrvqvisksnddeqyiwesnaggsftvtldevnerigrgtilrlflkdd
    qleyleekrikevikrhsefvaypiqlvvtkevekevpip
    

    Sequence, based on observed residues (ATOM records): (download)
    >2werB (B:)
    masetfefqaeitqlmsliintvysnkeiflreivsnasdaldkirykslsdpkqletep
    dlfiritpkpeqkvleirdsgigmtkaelinnlgtiaksgtkafmealsagadvsmigqf
    gvgfyslflvadrvqvisksnddeqyiwesnaggsftvtldevnerigrgtilrlflkdd
    qleyleekrikevikrhsefvaypiqlvvtkeve