Class a: All alpha proteins [46456] (290 folds) |
Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) |
Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins) |
Protein Methionyl-tRNA synthetase (MetRS) [47325] (3 species) this domain follows the Rossmann-fold catalytic domain of class I aaRS |
Domain d1a8ha1: 1a8h A:349-500 [16922] Other proteins in same PDB: d1a8ha2 complexed with zn |
PDB Entry: 1a8h (more details), 2 Å
SCOPe Domain Sequences for d1a8ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a8ha1 a.27.1.1 (A:349-500) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus [TaxId: 274]} laddlgnlvqrtramlfrfaegripepvageelaegtglagrlrplvrelkfhvaleeam ayvkalnryinekkpwelfkkepeearavlyrvveglriasilltpampdkmaelrralg lkeevrleeaerwglaeprpipeeapvlfpkk
Timeline for d1a8ha1: