![]() | Class a: All alpha proteins [46456] (138 folds) |
![]() | Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) |
![]() | Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family) ![]() |
![]() | Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (4 proteins) |
![]() | Protein Methionyl-tRNA synthetase (MetRS) [47325] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [47326] (1 PDB entry) |
![]() | Domain d1a8h_1: 1a8h 349-500 [16922] Other proteins in same PDB: d1a8h_2 |
PDB Entry: 1a8h (more details), 2 Å
SCOP Domain Sequences for d1a8h_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a8h_1 a.27.1.1 (349-500) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus} laddlgnlvqrtramlfrfaegripepvageelaegtglagrlrplvrelkfhvaleeam ayvkalnryinekkpwelfkkepeearavlyrvveglriasilltpampdkmaelrralg lkeevrleeaerwglaeprpipeeapvlfpkk
Timeline for d1a8h_1: